Чёрная книга АрхНадзора: московские утраты новейшей эпохи

4.63 Rating by CuteStat

This website is a sub-domain of archnadzor.ru. It has a global traffic rank of #1528852 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently by users, blackbook.archnadzor.ru is SAFE to browse.

PageSpeed Score
85
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 551
Daily Pageviews: 1,102

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 568
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,528,852
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.0.119

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.28.0.119)

Proxy Server - Free Proxy sites and Server Online

- proxyserver.pk

Proxy Server provides you anonymous surfing, protect your identity. Access free proxy sites to unblock restricted contents in your area, Proxyserver.pk

613,921 $ 1,200.00


Home : Petite

- wailanabeach.com
Not Applicable $ 8.95

NAIJAXTREME | Global Entertainment News Updates

- naijaxtreme.com

NAIJA XTREME is the largest online platform with latest news, Entertainment, sport, celebrity news, Unique Fashion and of course gossips.

1,771,568 $ 720.00

Dortmund Tickets - Der Preisvergleich

- dortmund-tickets.com

günstige Dortmund Tickets der Preisvergleich

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 06 Jan 2020 18:48:04 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 11 Jan 2017 17:54:45 GMT
Cache-Control: max-age=14400
CF-Cache-Status: HIT
Age: 681
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 550fdd30fd20ed3f-SJC
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
blackbook.archnadzor.ru A 300 IP: 104.28.1.119
blackbook.archnadzor.ru A 300 IP: 104.28.0.119
blackbook.archnadzor.ru AAAA 300 IPV6: 2606:4700:30::681c:177
blackbook.archnadzor.ru AAAA 300 IPV6: 2606:4700:30::681c:77

Similarly Ranked Websites

Index of /

- onlinemarketingreviewsandtips.com
1,528,854 $ 480.00

BoyneRewards

- boynerewards.com
1,528,854 $ 720.00

Home - Dark Knight News

- darkknightnews.com

The Dark Knight news is a fan based site dedicated to the iconic DC hero, Batman. Get the latest Batman news, Batman comic news & Dark Knight movie news!

1,528,855 $ 720.00

KiatNews.ID | Tajam Mengulas Fakta

- kiatnews.id

Tajam Mengulas Fakta

1,528,855 $ 960.00

Darshana Industries Pvt. Ltd. Pune

- darshanaindustries.com

Darshana Industries Pvt. Ltd.

1,528,856 $ 720.00